instruction
stringclasses 9
values | input
stringlengths 8
5.63k
| output
stringclasses 26
values |
|---|---|---|
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MPVARSWVCRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRR | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MKKWMMATAVVSLMALSACNNGDSEAVVETKNGAITKDEFYNEMKERVGKTVLRDLIDEKVLSKKYKVTD | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MLAVTSCSMKTVLQYAVFLGHSREVVCELVTSFRSFCSHCAVPPSPKYGGRHTVAMIPGDGIGPELMVHV | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MKSLVLLLCFAQLWSCQSAPQGAGLGFRELACDDPETEHVALIAVDYLNKHLLQGFRQILNQIDKVKVWS | tat |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MESLLAVQGQDFVLTASSSSAVRGITVLKPDDDKSQILNSHNLMLYCGEAGDTTNFAEYIAANISLYTLR | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MKKWFPAFLFLSLSGGNDALAGWHNVMFYAFNDYLTTNAGNVKVIDQPQLYIPWNTGSATATYYSCSGPE | tat |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MEENWDTEIETEKPTYVPNFSTLETENTDNYSAYSNNDINNQNYDSERSFGNRGGYRSERSRPSNFNRGS | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MSTVELNTSAGRIVLELNDAEAPKTVENFLAYVRSGHYDGTIFHRVISDFMIQGGGFTPDMQQKSTLAPI | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MGSSPPKKTTLQRYLSQLQQHPLRTKAITAGVLSGVSDVVSQKLSGIQKIQLRRVLLKVIFAGGFLGPAG | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MAPLRPLLMLALLAWVALADQESCKGRCTDGFIAERKCQCDELCSYYQSCCTDYVAECKPQVTRGDVFLQ | tat |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MVNEYKRIVLLRGLECINKHYFSLFKSLLARDLNLERDNQEQYTTIQIANMMEEKFPADSGLGKLIEFCE | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MTSGGSASRSGHRGVPMTSRGFDGSRRGSLRRAGARETASEAADGAAPAAGLRASPCSLASPSAAAAVAA | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MAAGGGLSRSERKAAERVRRLREEQQRERLRQVSRILRKAAAERSAEEGRLLAESEDLVTELQGRSRRRE | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MNSNRCQTNEVNKFISSTEKGPFTGRDNTLSFNKIGSRLNSPPILKDKIELKFLQHSEDLNQSRSYVNIR | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MSEAELEQTPSAGHVQEQPIEEEHEPEQEPTDAYTIGGPPRTPVEDAAAELSASLDVSGSDQSAEQSLDL | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MSFPYQHTSRSQVQPPLAAPGLSMFAPVSSSNSANSASSVAALLSHAPMYGLGQRRPSFLPGVSVPDTLS | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MGDWMTVTDPGLSSESKTISQYTSETKMSPSSLYSQQVLCSSIPLSKNVHSFFSAFCTEDNIEQSISYLD | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MNCLKICGFFFALIAALATAEAGTQVIHAGGHTLIQTDRSQYIRKN | tat |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MAAPMEVVVCTDAAAQLWSCVVWELHSGANLLTYRGGQAGPRGLALLNGEYLLAAQQGKNYICAWELQRK | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MDEFDGFTRPTSSNSSANRNSNNSMNRVENNNSNSDSANTVDSRGDAHTRMRQGFEKSFPSSPNKKRPRT | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MRKLKMMLCVMMLPLVVVGCTSKQSVSQCVKPPPPPAWIMQPPPDWQTPLNGIISPSGNDW | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MNHDFQALALESRGMGELLPTKKFWEPDDSTKDGQKGIFLGDDEWRETAWGASHHSMSQPIMVQRRSGQG | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MCDAAAATATTTTTAAVAAAVATTTASVALEATATQPGTTTTTVATASAGTTSPEAAIPTAATATSARNS | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MGCPNCGSTTFESDTASGNTYCTQCGVVVEQDAIVSEVTFGEASTGAAVVQGSLVSNDQTHARTFGGPYR | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MFRAGEASKRPLPGPSPPRVRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRAGDQILAVNEI | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MLKKLIGLLTILIIAVGFCGCMEQNIEKQTPTASEAPNTIKVVDLYGREVEVPKEVNRIVCCGPGCLRLI | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MLLQPVWKGCRWTQFVRPIRRWNSTGTNRGVPFSFKDISNQEDITNISYPSSSDSVLTKSNGSSEVYKPK | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MQIASITRRGFLKVACVTTGAALIGIRMTGKAVAAVKQIKDYMLDRINGVYGADAKFPVRASQDNTQVKA | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MSSSSSDENETTIHRTGSNTGGSGIYSQPRAGSSKRTSNVRHDVSDVDDEEEHYARFREDTAIEVDDAIT | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MSFHHLCSSPSSLLHDPLPLCNLLSVYPKSTPRSFLSSYNPNSSHFHSRNLLQATHVSVQEAIPQSEKSK | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MTLRKILALTCLLLPMMASAHQFETGQRVPPIGITDRGELVLDKDQFSYKTWNSAQLVGKVRVLQHIAGR | tat |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MHRRNLLKASMAIAAYTGLSATGLLASRAWAASGGAADGEAQAFDFETLKRQAKQLAGSAYQDTKQVLPP | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MASGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWGTAETNVSCPQCRETFPQRHMRPNRH | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MMDEGSVGDVSRIDEADVAHLQFKNSEQSFKPENIEVREVKEVQVQREAGSPDCSYGVIADFLDGKNGGD | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MRISRLLIRVLLGFVILFITYILFPSIPKALVNTLNVYKLEERLNYYNDRLLDGNLKSKELENATFVTLA | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MDILKSYHLLAAAYSAPAWASFMAGAFLVLTLSLSLFLVFDHLSTYKNPEEQKFLIGVILMVPCYSIESF | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MSTEPVVFMDIAIDGRLLGRIKIRLFSSIVPKTAENFRQFCTGETLGVNQKPIGYKNSTFHRIIQGFMIQ | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MMKSFFLVVTILALTLPFLGAQEQNQEQPICCEKDERFFDDKIAKYIPIQYVLSRYPSYGLNYYQQRPVA | tat |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKE | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEIS | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MAHVGDCTQTPWLPVLVVSLMCSARAEYSNCGENEYYNQTTGLCQECPPCGPGEEPYLSCGYGTKDEDYG | tat |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MSTAASDSGVEKLVEENKREEVKKNEEEKEFDLGLEENPDSVKKPRKRLAKFDEERLISENGIPKLRKMM | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MGGKSEPAKSESMATKPDLLNTSFFSFKSLKLKTKQQELLLRISILGLVYILAFIARLFSVLRYESMIHE | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIKGCGITFTLGKGTEVVVCAVN | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MTLRRLRKLQQKEEATAAPDPAGRAPDSEAARAAPLPSGPPAAAAPPGAPGEELYAALEDYHPAELYRAL | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MFQATSTGAQIMHAAFPRSWRRGHVLPLRSAKIFKPLACLELRGSTGIGGFHEIELKVRDYELDQFGVVN | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MRRNAQVFAMVLLLVLSGIPKALALYTPTPFSIDGNLEEWIKADAIAYGRDSGLPGANLDKLYIAWDDNY | tat |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MDDDGSLSIRNWGFYETMKGNLGLQLMPSVTGGHRDTKPLLPNGTFLQHHTPPHHPPHSHHPRDYGNGEP | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MVVPQKKFANGKRNDSTKSFKPMKKPFKKTKDDVAARSEAMALQLEDVPDFPRGGGTSLSKKEREKLYEE | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MERPSLRALLLGAAGLLLLLLPLSSSSSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEP | tat |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MASLLDSVTVTRVFSLPIAASVSSSSAAPSVSRRRISPARFLEFRGLKSSRSLVTQSASLGANRRTRIAR | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MVKIAIITYSTYGHIDVLAQAVKKGVEAAGGKADIYRVEETLPDEVLTKMNAPQKPEDIPVATEKTLLEY | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MSSNLIKSFGLIAIGAISGVTFTHFYYKGYQGSDVPDLTPRYTKFDSAGRALESIYDFNATKFFQYGIPG | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MSTTSGTGGVSYRNGTQRSSLRTQSSASTSSGGQKASVKSKSVLRKSSPAALGGGSSKSGGGGDAGVPGR | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MTLARLAPLAALLLAACAQFQPPPPEPDPLPDLMRQQTSLPQGGGVFTAGGSLSLTSDNRAFRPGDVLTV | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MHPKEGAEQHVFSPVPGAPTPPPNRCGRLVLGPRLPAAGTPGPGIRAAAARHALPLWGGGATRRGRRPAG | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MSTVLTYIRAVDIYEHMTESLDLEFESAYRGESVAFGEGVRPPWSIGEPQPELAALIVQGKFRGDVLDVG | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MSPEVALNRISPMLSPFISSVVRNGKVGLDATNCLRITDLKSGCTSLTPGPNCDRFKLHIPYAGETLKWD | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MATHTISRSILCRPAKSLSFLFTRSFASSAPLAKSPASSLLSRSRPLVAAFSSVFRGGLVSVKGLSTQAT | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MTASVLRSISLALRPTSGLLGTWQTQLRETHQRASLLSFWELIPMRSEPLRKKKKVDPKKDQEAKERLKR | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MRKMLAAVSRVLAGSAQKPASRVLVASRNFANDATFEIKKCDLHRLEEGPPVTTVLTREDGLKYYRMMQT | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MSTEDEKLLKEAKKLPWEDRLGHKNWKVRNEANVDLASVFDSITDPKDPRLRDFGHLFRKTVADSNAPVQ | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MRGPLGTEEELPRLFAEEMENEEEMSEEEDGGLEGFEDFFPAEPVSLPKKKPKKLKESKSSKGKRKKKEG | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MKFFIVLALCIVGAIADPVSSDQANAIRASWAGVKHNEVDILAAVFSDHPDIQARFPQFAGKDLASIKDT | tat |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MLTVSPAPVLIGNNSKDTYMAADFADFTTEDLPDFTTVGDFSDDLLDGIDYYDDLFIGFDGDDVLPDLEI | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MACSYILTPNPTKLNLSFAPSDLDAPSPSSSVSFTNTKPRRRKLSANSVSDTPNLLNFPNYPSPNPIIPE | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MDIEKIEDLKKFVASCEENPSILLKPELSFFKDFIESFGGKIKKDKMGYEKMKSEDSTEEKSDEEEEDEE | sec |
Determine the Signal peptides of following protein sequence, The result will be one of the following: sec,tat. | MPQRKISFYRLLPLATLLLAACSTTPPSGPATSPTSPQWRQHEQQLRQLSQFQTRGAFAYLSEKQKVYAR | sec |
Subsets and Splits
No saved queries yet
Save your SQL queries to embed, download, and access them later. Queries will appear here once saved.